PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KFK36721.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Arabideae; Arabis
Family Trihelix
Protein Properties Length: 299aa    MW: 35398.8 Da    PI: 7.3301
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KFK36721.1genomeMPIPBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix83.72.4e-2651133186
    trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqle 86 
                 +W+ +e+++Li++r e+++++ ++k++k lWe +s+kmr++ f rsp+qCk+kw+nl +ryk ++++e +    +++++p++d+++
  KFK36721.1  51 QWSIEETKELIRIRGELDQTFMETKRNKLLWEVISNKMRDKSFPRSPEQCKCKWKNLVTRYKGCETMEAEI---ARQQFPFYDDMQ 133
                 7********************************************************************97...45679*****96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM007170.004248110IPR001005SANT/Myb domain
CDDcd122035.61E-2350115No hitNo description
PfamPF138376.2E-2151133No hitNo description
PROSITE profilePS500907.85152108IPR017877Myb-like domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005730Cellular Componentnucleolus
GO:0016592Cellular Componentmediator complex
Sequence ? help Back to Top
Protein Sequence    Length: 299 aa     Download sequence    Send to blast
MDGHQHHLHQ LQYLNKHQQQ HHHPSQSQTL EIASPAASAA AVAAAGDRFP QWSIEETKEL  60
IRIRGELDQT FMETKRNKLL WEVISNKMRD KSFPRSPEQC KCKWKNLVTR YKGCETMEAE  120
IARQQFPFYD DMQIIFSCRM QRMLWGETEG GGGGTSGTVK KRGHSEQFSS DEEEENVNEE  180
LVDISVNDPK ILNPKKSIAK KRKGGSNSSV REVLDEFMRH QMRMENEWRE RWEAREKERA  240
EKEEEWRRKM EELEKERVAM ERMWQDREEQ RRSREEIRAE KRDSLINALL AKLTRDGSI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2ebi_A2e-1248129384DNA binding protein GT-1
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1193202PKKSIAKKRK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF4535820.0AF453582.1 Arabidopsis thaliana GT-1 like transcription factor (GT1L) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013740623.11e-148PREDICTED: trihelix transcription factor GT-3b-like
RefseqXP_009133240.11e-148PREDICTED: trihelix transcription factor GT-3b-like
SwissprotO804501e-123TGT3B_ARATH; Trihelix transcription factor GT-3b
TrEMBLA0A087H3L90.0A0A087H3L9_ARAAL; Uncharacterized protein
STRINGBra000046.1-P1e-148(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM22152870
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38250.19e-94Trihelix family protein